Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

Title:

Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

identifier:	1494464
description:	epitope description:RYHNTVTKTIETHTDNIETNMDENLRIPVTAEVGSGYFKM antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108D2, P111B10
aggregation:	instance of dataset
availability:	available
primaryPublications:	18538134

study type:	b cell assays
subject species:	Shrimp white spot syndrome virus

fullName:	Yuzhen Wang Xiaohua Zhang Li Yuan Tao Xu Yu Rao Jia Li Heping Dai

method:	ELISA

name:	Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.
description:	The epitope sequence was provided by the cited reference Tang et al, J Virol Vol81, 12 (2007) [PMID:17409146]. The epitope was deduced by the use of overlapping fragments. The mAbs were shown to be epitope specific by binding overlapping peptide fragments.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.