Immunological Data Discovery Index
Immunological Data Discovery Index
| identifier: | 1495381 |
| description: |
epitope description:PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASAVEIKFSNGSQDILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHRFGSIAIVTFSPEYSFRFNDNCMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLRTKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR
antigen name:Botulinum neurotoxin type E
host organism:Mus musculus BALB/c
antibody name:EL161-38, EL221-3, EL219-15
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
2450068 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1001607 |
| landingPage: |
http://www.iedb.org/assay/1495381 |
| type: |
Literature
|
| publicationVenue: |
Infect Immun
|
| dates: |
1988
|
| study type: | b cell assays |
| subject species: | Clostridium botulinum str. Iwanei E |
| fullName: |
K Tsuzuki
N Yokosawa
B Syuto
I Ohishi
N Fujii
K Kimura
K Oguma
|
| method: |
ELISA
|
| name: |
Establishment of a monoclonal antibody recognizing an antigenic site common to Clostridium botulinum type B, C1, D, and E toxins and tetanus toxin.
|
| description: |
A complete sequence for the BONT/E of Iwanai strain could not be found in the curent Swiss-prot/Genebank databases. The accession provided here is stated to be based in the sequences of the BONT/E strains Beluga and Hazen 3620.
Three monoclonal antibodies raised against the light chain fragment of BONT/E are shown to recognize BONT/E by ELISA, and its LC fragment in WB, and to have cross-reactive binding to toxins of the C1, D and F types, to Tetanus toxin, and weakly to type B BONT, indicating that there exists at least one common antigenic determinant on the LC regions of these toxins. No reaction to types A, F or C2 was observed, nor to C.perfringens enterotoxin. No neutralization activity was detected for any of the 3 mAbs.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |
