DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.

Title:

DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.

identifier:	1498339
description:	epitope description:TTTYTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus antibody name:SD6
aggregation:	instance of dataset
availability:	available
primaryPublications:	16563575

study type:	b cell assays
subject species:	Foot-and-mouth disease virus C-S8c1

fullName:	Belen Borrego Paloma Fernandez-Pacheco Llilianne Ganges Nieves Domenech Natalia Fernandez-Borges Francisco Sobrino Fernando Rodrí guez

method:	immuno staining

name:	DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.
description:	The epitope sequence is from the reference cited: Toja et al. (1999) Virus Res 64: 161-171 [PMID: 10518172]. The epitope-specific mAb SD6 immunostained 2% of BHK-21 cells transfected with a plasmid containing a linear construct of the epitope and the T cell epitopes from FMDV, 3A (11-40) (YFLIEKGQHEAAIEFFEGMVHDSIKEELRP) and VP4 (20-34) (SIINNYYMQQYQNSM). A higher percentage of positive cells was achieved by using a construct with a signal peptide from human prion protein fused to the FMDV peptides.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.