DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.

Title:

DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.

identifier:	1498340
description:	epitope description:TTTYTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus Swiss
aggregation:	instance of dataset
availability:	available
primaryPublications:	16563575

study type:	b cell assays
subject species:	Foot-and-mouth disease virus C-S8c1

fullName:	Belen Borrego Paloma Fernandez-Pacheco Llilianne Ganges Nieves Domenech Natalia Fernandez-Borges Francisco Sobrino Fernando Rodrí guez

method:	biological activity

name:	DNA vaccines expressing B and T cell epitopes can protect mice from FMDV infection in the absence of specific humoral responses.
description:	The epitope sequence is from the reference cited: Toja et al. (1999) Virus Res 64: 161-171 [PMID: 10518172]. Serum from 1 of 31 outbred Swiss ICR-CD1 mice immunized with a plasmid containing a linear construct of the epitope and the T cell epitopes from FMDV, 3A (11-40) (YFLIEKGQHEAAIEFFEGMVHDSIKEELRP) and VP4 (20-34) (SIINNYYMQQYQNSM) developed virus neutralizing antibodies that also reacted with FMDV C-S8c1 by ELISA. The predominant isotype was IgG2a, indicating a Th1 biased response. The positive serum was from one of 4 mice immunized with a construct with a signal peptide from human prion protein fused to the FMDV peptides. Fifteen other mice immunized with constructs with signal peptides or targeting sequences did not respond.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.