A peptide domain on gingipain R which confers immunity against Porphyromonas gingivalis infection in mice.

Title:

A peptide domain on gingipain R which confers immunity against Porphyromonas gingivalis infection in mice.

identifier:	1499800
description:	epitope description:QLPFIFDVACVNGDFLFSMPCFAEALMRAQ antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c
aggregation:	instance of dataset
availability:	available
primaryPublications:	9712755

study type:	b cell assays
subject species:	Porphyromonas gingivalis HG66

fullName:	C A Genco B M Odusanya J Potempa J Mikolajczyk-Pawlinska J Travis

method:	in vivo assay

name:	A peptide domain on gingipain R which confers immunity against Porphyromonas gingivalis infection in mice.
description:	The authors numbering corresponds to the mature 95-kDa form, known as gingipain R1. Seven weeks after the first immunization, mice were challenged by inoculation of approximately 10^9 CFU of P. gingivalis A7436 directly into the subcutaneous implanted chambers.Animals immunized with MAP-conjugated peptide B followed by challenge presented a high score for cachexia (ruffled hair, hunched bodies, and weight loss). Viable organisms were also cultured from the chamber fluid.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.