| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1013035 |
| landingPage: |
http://www.iedb.org/assay/1501369 |
| type: |
Literature
|
| publicationVenue: |
Virus Res
|
| dates: |
2004
|
| study type: | b cell assays |
| subject species: | Lactate dehydrogenase-elevating virus |
| fullName: |
Peter G W Plagemann
|
| method: |
antigen inhibition
|
| name: |
GP5 ectodomain epitope of porcine reproductive and respiratory syndrome virus, strain Lelystad virus.
|
| description: |
The peptide LV-P7 weakly inhibited the binding of epitope-specific mAb 159-18 to peptide LDV-P6 (ACGASNSSTKNLKYNLTLCELNVTGFQQHF).
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |