A peptide of foot-and-mouth disease virus serotype Asia1 generating a neutralizing antibody response, and an immunostimulatory peptide.

Title:

A peptide of foot-and-mouth disease virus serotype Asia1 generating a neutralizing antibody response, and an immunostimulatory peptide.

identifier:	1504625
description:	epitope description:KTTYGEESTSRGDPSALAQRLSGRLPTSFNY antigen name:Genome polyprotein host organism:Cavia porcellus
aggregation:	instance of dataset
availability:	available
primaryPublications:	17656048

study type:	b cell assays
subject species:	Foot-and-mouth disease virus - type Asia 1

fullName:	Jia-Long Wang Ming-Qiu Liu Ji Han Wei-Zao Chen Wei Cong Gong Cheng Yan-Hua Gao Yong-Gan Lu Jiu-Lian Chen Xiao-Ping Zuo Wei-Yao Yan Zhao-Xin Zheng

method:	biological activity

name:	A peptide of foot-and-mouth disease virus serotype Asia1 generating a neutralizing antibody response, and an immunostimulatory peptide.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.