Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

Title:

Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

identifier:	1508176
description:	epitope description:MAEEPTYTTEQVDELIHAGLGTVDFFLSRPIDAQSSLGKGSIPPGVT antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibody name:13-1A, 84-1A, 151A, 311
aggregation:	instance of dataset
availability:	available
primaryPublications:	9191922

study type:	b cell assays
subject species:	Human rubulavirus 2

fullName:	M Nishio M Tsurudome M Ito N Watanabe M Kawano H Komada Y Ito

method:	immunoprecipitation

name:	Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.
description:	The epitope sequence is from the reference cited: Ohgimoto et al. (1990) Virol 177: 116-123 [PMID: 2162103]. The epitope was deduced. The epitope-specific mAbs immunoprecipitated P protein from lysates of transfected COS cells. The epitope was mapped by reactivity of the mAbs with deletion mutants of P expressed in COS cells and analyzed by Western blotting of the cell lysates.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.