| identifier: | 1508259 |
| description: |
epitope description:ANDCISRPDTKTEFVTKIQAATTESQLNEIKRSIIRSAI
antigen name:Human rubulavirus 2 protein
host organism:Mus musculus
antibody name:2-1A, 5A, 14-1A, 31A, 34-1A, 57-1A, 89-1A, 100A, 106A, 130-2A, 153-1A, 308-1, 335A, 360-1
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
9191922 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1009315 |
| landingPage: |
http://www.iedb.org/assay/1508259 |
| type: |
Literature
|
| publicationVenue: |
J Gen Virol
|
| dates: |
1997
|
| study type: | b cell assays |
| subject species: | Human rubulavirus 2 |
| fullName: |
M Nishio
M Tsurudome
M Ito
N Watanabe
M Kawano
H Komada
Y Ito
|
| method: |
immunoprecipitation
|
| name: |
Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.
|
| description: |
The epitope sequence is from the reference cited: Ohgimoto et al. (1990) Virol 177: 116-123 [PMID: 2162103]. The epitope was deduced.
The epitope-specific mAbs immunoprecipitated P protein from lysates of transfected COS cells. The epitope was mapped by reactivity of the mAbs with deletion mutants of P protein expressed in COS cells and analyzed by Western blotting of the cell lysates.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |