| identifier: | 1509887 |
| description: |
epitope description:EFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRK
antigen name:Recombination endonuclease VII
host organism:Mus musculus C57BL/6 X BALB/c
antibody name:D12, D27, D36, D63, D91, D172, D176, D177, D234, D247, D249, D255, D256
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
9533878 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1011895 |
| landingPage: |
http://www.iedb.org/assay/1509887 |
| type: |
Literature
|
| publicationVenue: |
J Mol Biol
|
| dates: |
1998
|
| study type: | b cell assays |
| subject species: | Enterobacteria phage T4 |
| fullName: |
A Christoph
G v Heesberg
B Kemper
|
| method: |
ELISA
|
| name: |
Epitope mapping of T4 endonuclease VII with monoclonal antibodies reveals importance of both ends of the protein for target binding.
|
| description: |
The minimal epitope recognized by the mAbs was determined by analysis of reactivity with fragments of endonuclease VII (EVII) and C-terminally truncated EVII protein. The mAbs reacted with fragments 66-157 and 115-157, but not with 125-157. MAbs D12 and D256 were also shown to react with EVII 1-154, but further truncation reduced reactivity. All mAbs were of the IgG1 subclass, except D27 was IgM.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |