| Title: | Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase. |
| identifier: | 1542302 |
| description: |
epitope description:EKPAKTYDDAASESSDDDDIDALIEELQSNHGVDDEDSDNDGPVAAGEARPVPEEYLQ
antigen name:Plasma membrane ATPase 1
host organism:Oryctolagus cuniculus
antibody name:affinity-purified anti-ATPase
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
7681777 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1011285 |
| landingPage: |
http://www.iedb.org/assay/1542302 |
| type: |
Literature
|
| publicationVenue: |
Eur J Biochem
|
| dates: |
1993
|
| study type: | b cell assays |
| subject species: | Saccharomyces cerevisiae |
| fullName: |
R Serrano
B C Monk
J M Villalba
C Montesinos
E W Weiler
|
| method: |
western blot
|
| name: |
Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.
|
| description: |
The epitope sequence is from the reference cited: Serrano et al.(1986) Nature 319: 689-693 [PMID: 3005867].
The epitope was selected by affinity-purified rabbit anti-ATPase antibody from a library containing random fragments of ATPase expressed as beta-galactosidase fusion proteins.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |