Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

Title:

Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

identifier:	1511784
description:	epitope description:DLKCSLPHRNESNKWTCAARRKGSRRDSLYIAGRDFWGR antigen name:envelope polyprotein host organism:Ovis aries
aggregation:	instance of dataset
availability:	available
primaryPublications:	10482555

study type:	b cell assays
subject species:	Visna lentivirus (strain 1514 / clone LV1-1KS1)

fullName:	R Skraban S Matthí asdó ttir S Torsteinsdó G Agnarsdó B Gudmundsson G Georgsson R H Meloen O S André sson K A Staskus H Thormar V André sdó

method:	biological activity

name:	Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.
description:	This region differs in four substitutions and two deletions between the molecular clones LV1-1KS1 and KV1772kv72/67. The KV1772kv72/67 virus with the epitope region exchanged for the sequence of LV1-1KS1 (recombinant virus VR1) is not neutralized by KV1772kv72/67 specific sera, implying there is no cross-reactive recognition of the epitope.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.