Synthesis of bluetongue virus chimeric VP3 molecules and their interactions with VP7 protein to assemble into virus core-like particles.

Title:

Synthesis of bluetongue virus chimeric VP3 molecules and their interactions with VP7 protein to assemble into virus core-like particles.

identifier:	1513720
description:	epitope description:ATGWQTIDGKKYYFNTNTAEAATGWQTIDGKKYYFNTNTAIAST antigen name:Toxin A host organism:Mus musculus BALB/c antibody name:Anti-toxin A
aggregation:	instance of dataset
availability:	available
primaryPublications:	8553561

study type:	b cell assays
subject species:	Clostridioides difficile

fullName:	S M Mikhailov P Roy

method:	western blot

name:	Synthesis of bluetongue virus chimeric VP3 molecules and their interactions with VP7 protein to assemble into virus core-like particles.
description:	The epitope-specific mAb(s) recognized the epitope expressed as part of VP3 protein of Bluetonge virus using baculovirus vector.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.