| identifier: | 1603441 |
| description: |
epitope description:HDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKES
antigen name:Mesocricetus auratus (Syrian golden hamster) protein
host organism:Mus musculus PrP null
antibody name:8E9
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
18977037 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1013696 |
| landingPage: |
http://www.iedb.org/assay/1603441 |
| type: |
Literature
|
| publicationVenue: |
J Neuroimmunol
|
| dates: |
2008
|
| study type: | b cell assays |
| subject species: | Mesocricetus auratus |
| fullName: |
Binggong Chang
Michael W Miller
Marie S Bulgin
Sharon Sorenson-Melson
Aru Balachandran
Allen Chiu
Richard Rubenstein
|
| method: |
western blot
|
| name: |
PrP antibody binding-induced epitope modulation evokes immunocooperativity.
|
| description: |
The epitope sequence is from the reference cited: Stahl and Prusiner (1991) FASEB J 5: 2799-2807 [PMID: 1916104].
The epitope-specific mAb recognized PrP from untreated and PK-treated total brain lysates from 263K-infected hamsters. The mAb recognized the diglycosylated, monoglycosylated, and unglycosylated PrPSc forms. Denaturation with SDS, heat, or both increased reactivity of the mAb with purified PrPSc by ELISA.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |