IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

Dataset

identifier:	1603575
description:	epitope description:LDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVMKSSVIN antigen name:Hev b 6 host organism:Oryctolagus cuniculus antibody name:anti-MNA
aggregation:	instance of dataset
availability:	available
primaryPublications:	9548517

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1013974
landingPage:	http://www.iedb.org/assay/1603575

Publication

type:	Literature
publicationVenue:	J Immunol
dates:	1997

Dimension

study type:	b cell assays
subject species:	Hevea brasiliensis

Person

fullName:	B Banerjee X Wang K J Kelly J N Fink G L Sussman V P Kurup

Data Type

method:	western blot

Study

name:	IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.
description:	The epitope sequence is from the reference cited: Broekaert et al. (1990) Proc. Natl. Acad. Sci. U.S.A. 87: 7633-7637 [PMID: 2217194]. Rabbit anti-MNA serum reacted with the epitope expressed as a fusion protein with maltose binding protein.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.