Murine gammaherpesvirus-68 glycoprotein B presents a difficult neutralization target to monoclonal antibodies derived from infected mice.

Title:

Murine gammaherpesvirus-68 glycoprotein B presents a difficult neutralization target to monoclonal antibodies derived from infected mice.

identifier:	1617142
description:	epitope description:QPTTLRQPSDMTPAQDAPTETPPPLSTNTNRGFEYFRVCGV antigen name:envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:2C10
aggregation:	instance of dataset
availability:	available
primaryPublications:	17098966

study type:	b cell assays
subject species:	Murid gammaherpesvirus 4

fullName:	Laurent Gillet Michael B Gill Susanna Colaco Christopher M Smith Philip G Stevenson

method:	biological activity

name:	Murine gammaherpesvirus-68 glycoprotein B presents a difficult neutralization target to monoclonal antibodies derived from infected mice.
description:	The peptide is derived from the genomic MHV-68 (a.k.a. Murid herpesvirus 4) sequence described in the cited reference Adler et al, J Virol 74, 6964&ndash 6974 (2000) [PMID 10888635]. Neutralization by epitope-specific mAb was tested in vivo. The virus (1 p.f.u) was incubated with the mAb (1μg) and inoculated intranasally to mice. There was no reduction of viral titers in the lung obtained from those mice compared with controls.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.