Production and characterization of a peptide specific, anti-major histocompatibility complex class II, monoclonal antibody.

Title:

Production and characterization of a peptide specific, anti-major histocompatibility complex class II, monoclonal antibody.

identifier:	1795929
description:	epitope description:AEYWNSQPEILERTRAELDTVCRHNYEGPETH antigen name:H-2 class II histocompatibility antigen, A beta chain host organism:Cricetulus migratorius antibody name:KL277
aggregation:	instance of dataset
availability:	available
primaryPublications:	1648172

study type:	b cell assays
subject species:	Mus musculus

fullName:	K E LaPan D G Klapper J A Frelinger

method:	ELISA

name:	Production and characterization of a peptide specific, anti-major histocompatibility complex class II, monoclonal antibody.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.