Epitope spreading and a varying but not disease-specific GAD65 antibody response in Type I diabetes. The Childhood Diabetes in Finland Study Group.

Title:

Epitope spreading and a varying but not disease-specific GAD65 antibody response in Type I diabetes. The Childhood Diabetes in Finland Study Group.

Dataset

identifier:	1619813
description:	epitope description:HTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIK antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	10753043

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1007532
landingPage:	http://www.iedb.org/assay/1619813

Publication

type:	Literature
publicationVenue:	Diabetologia
dates:	2000

Dimension

study type:	b cell assays
subject species:	Homo sapiens

Person

fullName:	P Sö hnlein M Mü ller K Syren U Hartmann B O Bö hm H M Meinck M Knip H K Akerblom W Richter

Data Type

method:	western blot

Study

name:	Epitope spreading and a varying but not disease-specific GAD65 antibody response in Type I diabetes. The Childhood Diabetes in Finland Study Group.
description:	The epitope sequence is from the reference cited: Schwartz et al. (1999) J Mol Biol 287: 983-999 [PMID: 10222205]. The epitope was deduced. Patient sera did not react with the epitope based on (lack of) reactivity with overlapping fragments of GAD65 protein expressed as a fusion protein with glutathione S. transferase. Sera from 10 patients with PAS without diabetes and sera from 11 PAS patients with diabetes did not react.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.