Epitope mapping and topographic analysis of VAR2CSA DBL3X involved in P. falciparum placental sequestration.

Title:

Epitope mapping and topographic analysis of VAR2CSA DBL3X involved in P. falciparum placental sequestration.

identifier:	1635786
description:	epitope description:YTNIGNEAFKQIKECDIPAELEDVIYRLKH host organism:Oryctolagus cuniculus
aggregation:	instance of dataset
availability:	available
primaryPublications:	17112315

study type:	b cell assays
subject species:

fullName:	Madeleine Dahlbä ck Thomas S Rask Pernille H Andersen Morten A Nielsen Nicaise T Ndam Mafalda Resende Louise Turner Philippe Deloron Lars Hviid Ole Lund Anders Gorm Pedersen Thor G Theander Ali Salanti

method:	ELISA

name:	Epitope mapping and topographic analysis of VAR2CSA DBL3X involved in P. falciparum placental sequestration.
description:	The peptide has the two middle residues from the natural sequence replaced by a cysteine. This is thought to induce some conformational restrain. A pepscan analysis was performed to evaluate the validity of the analysis method used for the human reactivity data, in which each residue is assigned a value as a function of the times it is represented in positively recognized peptides.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.