Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

Title:

Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

identifier:	1641365
description:	epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:8G7
aggregation:	instance of dataset
availability:	available
primaryPublications:	16908985

study type:	b cell assays
subject species:	Homo sapiens

fullName:	M Hasan Mohajeri Meret N M Gaugler Julia Martinez Jay Tracy Hong Li Arames Crameri Katrin Kuehnle M Axel Wollmer Roger M Nitsch

method:	western blot

name:	Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.