Immunogenicity of CIGB-230, a therapeutic DNA vaccine preparation, in HCV-chronically infected individuals in a Phase I clinical trial.

Title:

Immunogenicity of CIGB-230, a therapeutic DNA vaccine preparation, in HCV-chronically infected individuals in a Phase I clinical trial.

identifier:	1641444
description:	epitope description:TGTYVTGGTAARGVSQFTGLFTSGPSQKIQL antigen name:Genome polyprotein host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	19017255

study type:	b cell assays
subject species:	Hepatitis C virus subtype 1b

fullName:	L Alvarez-Lajonchere N H Shoukry B Grá Y Amador-Cañ izares F Helle N Bé dard I Guerra C Drouin J Dubuisson E E Gonzá lez-Horta G Martí nez J Marante Z Cinza M Castellanos S Dueñ as-Carrera

method:	ELISA

name:	Immunogenicity of CIGB-230, a therapeutic DNA vaccine preparation, in HCV-chronically infected individuals in a Phase I clinical trial.
description:	The peptide sequence was derived from the cited reference, Duenas-Carrera et al, J Pept Res. 58(3):22 (2001) [PMID: 11576328]. The epitope-specific responses were not different in the patients before or after the vaccination protocol. The responses were mainly of IgG type, and responses of IgM type were also detected in 2 of the patients, but no IgA responses were detected.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.