Endogenous C-terminal fragments of beta-amyloid precursor protein from Xenopus laevis skin exudate.

Title:

Endogenous C-terminal fragments of beta-amyloid precursor protein from Xenopus laevis skin exudate.

identifier:	1648957
description:	epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus
aggregation:	instance of dataset
availability:	available
primaryPublications:	17270477

type:	Literature
publicationVenue:	Comp Biochem Physiol B Biochem Mol Biol
dates:	2007

study type:	b cell assays
subject species:	Homo sapiens

fullName:	Christine Clamagirand Boutaï na El Abida P Arsene Der Garabedian Chantal Hanquez Lionel Dubost Arul Marie Mohamed Rholam Bertrand Friguet Paul Cohen

method:	western blot

name:	Endogenous C-terminal fragments of beta-amyloid precursor protein from Xenopus laevis skin exudate.
description:	The epitope-specific mAb reacted with a 30K protein from frog skin exudate that was shown to be homologous to human APP.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.