| Title: | Antibodies to the buried N terminus of rhinovirus VP4 exhibit cross-serotypic neutralization. |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1014894 |
| landingPage: |
http://www.iedb.org/assay/1652666 |
| type: |
Literature
|
| publicationVenue: |
J Virol
|
| dates: |
2009
|
| study type: | b cell assays |
| subject species: | Rhinovirus B14 |
| fullName: |
Umesh Katpally
Tong-Ming Fu
Daniel C Freed
Danilo R Casimiro
Thomas J Smith
|
| method: |
ELISA
|
| name: |
Antibodies to the buried N terminus of rhinovirus VP4 exhibit cross-serotypic neutralization.
|
| description: |
The polyclonal antibody raised against the 30-mer HRV14 VP4 peptide (GAQVSTQKSGSHENQNILTNGSNQTFTVINY) did not react with the epitope by ELISA.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |