Cloning, expression, and mapping of allergenic determinants of alphaS1-casein, a major cow's milk allergen.

Title:

Cloning, expression, and mapping of allergenic determinants of alphaS1-casein, a major cow's milk allergen.

identifier:	1650930
description:	epitope description:ISSSEEIVPNSVEQKHIQKEDVPSERYLGYLEQLLR antigen name:Bos d 9 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	19454699

study type:	b cell assays
subject species:	Bos taurus

fullName:	Ulrike Schulmeister Heidrun Hochwallner Ines Swoboda Margarete Focke-Tejkl Beate Geller Mats Nystrand Annika Hä rlin Josef Thalhamer Sandra Scheiblhofer Walter Keller Bodo Niggemann Santiago Quirce Christoph Ebner Adriano Mari Gabrielle Pauli Udo Herz Rudolf Valenta Susanne Spitzauer

method:	western blot

name:	Cloning, expression, and mapping of allergenic determinants of alphaS1-casein, a major cow's milk allergen.
description:	Among alpha S1-casein positive patients (n=37), 73% recognized the epitope.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.