| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1014838 |
| landingPage: |
http://www.iedb.org/assay/1668093 |
| type: |
Literature
|
| publicationVenue: |
J Neurochem
|
| dates: |
1986
|
| study type: | b cell assays |
| subject species: | Homo sapiens |
| fullName: |
C H Chou
A A Cox
R B Fritz
J G Wood
R F Kibler
|
| method: |
radio immuno assay (RIA)
|
| name: |
Monoclonal antibodies to human myelin basic protein.
|
| description: |
The epitope specific mAb reacted to guinea pig MBP peptide 1-38: ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGIL.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |