| identifier: | 1684671 |
| description: |
epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDQDPVVHF
antigen name:Myelin basic protein (UniProt:P02686)
host organism:Oryctolagus cuniculus New Zealand White
antibody name:G1
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
2429613 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1006929 |
| landingPage: |
http://www.iedb.org/assay/1684671 |
| type: |
Literature
|
| publicationVenue: |
Ann Neurol
|
| dates: |
1986
|
| study type: | b cell assays |
| subject species: | Homo sapiens |
| fullName: |
J N Whitaker
M Gupta
O F Smith
|
| method: |
antigen inhibition
|
| name: |
Epitopes of immunoreactive myelin basic protein in human cerebrospinal fluid.
|
| description: |
The epitope sequence was from the cited reference: Carnegie P. R. et al. (1971) Biochem. J. 123, 57-67. [PMID: 4108501].
The epitope inhibited New Zealand White rabbit antisera to human MBP binding to the epitope at a high level and inhibited binding to human MBP at a low level. The fragment (45-88) of human MBP inhibited binding to the epitope at a low level. The epitope directly bound New Zealand White rabbit antisera to human MBP by immunoprecipitation.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |