Epitopes of the p70 and p80 (Ku) lupus autoantigens. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

Epitopes of the p70 and p80 (Ku) lupus autoantigens.

Dataset

identifier:	1692996
description:	epitope description:LTLPKVEAMNKRLGSLVDEFKELVYPPDYN antigen name:X-ray repair cross-complementing protein 6 host organism:Mus musculus BALB/c antibody name:162, 111
aggregation:	instance of dataset
availability:	available
primaryPublications:	1707916

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1007367
landingPage:	http://www.iedb.org/assay/1692996

Publication

type:	Literature
publicationVenue:	J Immunol
dates:	1991

Dimension

study type:	b cell assays
subject species:	Homo sapiens

Person

fullName:	W H Reeves A Pierani C H Chou C Nicastri R G Roeder Z M Sthoeger

Data Type

method:	western blot

Study

name:	Epitopes of the p70 and p80 (Ku) lupus autoantigens.
description:	The epitope sequence can be found in the cited reference: Westley and Sthoeger (1989) J Biol Chem 9:5047 [PMID: 2466842].

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.