Measles viruses of genotype H1 evade recognition by vaccine-induced neutralizing antibodies targeting the linear haemagglutinin noose epitope.

Title:

Measles viruses of genotype H1 evade recognition by vaccine-induced neutralizing antibodies targeting the linear haemagglutinin noose epitope.

identifier:	1695780
description:	epitope description:ETCFQQACKGKIQALCENPEWAPLKDNRIPSY antigen name:Hemagglutinin glycoprotein host organism:Mus musculus antibody name:BH6, BH216
aggregation:	instance of dataset
availability:	available
primaryPublications:	19625457

study type:	b cell assays
subject species:	Measles virus strain Edmonston-Zagreb

fullName:	Tim Finsterbusch Anne Wolbert Ingrid Deitemeier Kerstin Meyer Maria Mar Mosquera Annette Mankertz Sabine Santibanez

method:	biological activity

name:	Measles viruses of genotype H1 evade recognition by vaccine-induced neutralizing antibodies targeting the linear haemagglutinin noose epitope.
description:	The epitope-specific mAb was able to neutralize Measles virus MVi/Tuebingen.DEU/10.08.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.