A new epitope of CYP2D6 recognized by liver kidney microsomal autoantibody from japanese patients with autoimmune hepatitis.

Title:

A new epitope of CYP2D6 recognized by liver kidney microsomal autoantibody from japanese patients with autoimmune hepatitis.

identifier:	1710410
description:	epitope description:AVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLK antigen name:Cytochrome P450 2D6 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	16327157

study type:	b cell assays
subject species:	Homo sapiens

fullName:	Susumu Imaoka Noriko Obata Toyoko Hiroi Mayuko Osada-Oka Rie Hara Shuhei Nishiguchi Yoshihiko Funae

method:	ELISA

name:	A new epitope of CYP2D6 recognized by liver kidney microsomal autoantibody from japanese patients with autoimmune hepatitis.
description:	The epitope sequence was found in the cited reference Kerkar et al., J Immunol. 2003 Feb 1 170(3):1481-9 [PMID: 12538711]. Sera from both HCV-negative patients and three HCV-positive patients reacted with the epitope.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.