Efficacy of antibodies against a chimeric synthetic peptide encompassing epitopes of bonnet monkey (Macaca radiata) zona pellucida-1 and zona pellucida-3 glycoproteins to inhibit in vitro human sperm-egg binding.

Title:

Dataset

identifier:	1710700
description:	epitope description:DRAVYENELVATRDVKNGSRGSVGGGKGDCGTPSHSRRQPHVVSQWSRSA host organism:Mus musculus BALB/c
aggregation:	instance of dataset
availability:	available
primaryPublications:	15625695

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1017024
landingPage:	http://www.iedb.org/assay/1710700

Publication

type:	Literature
publicationVenue:	Mol Reprod Dev
dates:	2005

Dimension

study type:	b cell assays
subject species:

Person

fullName:	Neela Sivapurapu Akiko Hasegawa Gagandeep K Gahlay Koji Koyama Satish K Gupta

Data Type

method:	protection from fertility

Study

name:	Efficacy of antibodies against a chimeric synthetic peptide encompassing epitopes of bonnet monkey (Macaca radiata) zona pellucida-1 and zona pellucida-3 glycoproteins to inhibit in vitro human sperm-egg binding.
description:	The epitope encompassing the bmZP1(251&ndash 273) and bmZP3(324&ndash 347) epitopes, was separated by a tri-glycine spacer. The antibodies against the epitope exhibited a significant inhibition in the sperm binding to ZP in HZA. The inhibition was markedly stronger than those of the antisera against the individual bmZP1(251–273) and bmZP3(324–347) peptides.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Related Publications

Feedback?