Mouse vaccination with dendritic cells loaded with prion protein peptides overcomes tolerance and delays scrapie.

Title:

Mouse vaccination with dendritic cells loaded with prion protein peptides overcomes tolerance and delays scrapie.

identifier:	1716902
description:	epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6
aggregation:	instance of dataset
availability:	available
primaryPublications:	19864503

study type:	b cell assays
subject species:	Mus musculus

fullName:	Vé ronique Bachy Clara Ballerini Pauline Gourdain Auré lie Prignon Saci Iken Nadine Antoine Martine Rosset Claude Carnaud

method:	ELISA

name:	Mouse vaccination with dendritic cells loaded with prion protein peptides overcomes tolerance and delays scrapie.
description:	The epitope sequence was found in the cited reference, Gregoire et al, J Leukoc Biol: 76(1) 2004 [PMID: 15075357].

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.