Cicatricial pemphigoid: IgA and IgG autoantibodies target epitopes on both intra- and extracellular domains of bullous pemphigoid antigen 180.

Title:

Cicatricial pemphigoid: IgA and IgG autoantibodies target epitopes on both intra- and extracellular domains of bullous pemphigoid antigen 180.

identifier:	1760573
description:	epitope description:ADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGIS antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	11736901

study type:	b cell assays
subject species:	Homo sapiens

fullName:	E Schmidt C Skrobek A Kromminga T Hashimoto G Messer E B Brö cker K B Yancey D Zillikens

method:	western blot

name:	Cicatricial pemphigoid: IgA and IgG autoantibodies target epitopes on both intra- and extracellular domains of bullous pemphigoid antigen 180.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.