Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

Title:

Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

identifier:	1761534
description:	epitope description:LLKENTSLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKR antigen name:Leiomodin-1 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	7586727

study type:	b cell assays
subject species:	Homo sapiens

fullName:	Z G Zhang J R Wall N F Bernard

method:	western blot

name:	Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.
description:	The epitope sequence is from the reference cited: Dong et al. (1991) Clin Endocrinol Metab 72: 1375-1381 [PMID: 2026759]. Sera from 2 of 9 Graves' disease patients recognized the epitope expressed as a fusion protein. The reactive sera also recognized D1 fragment 426-524, suggesting an epitope is located between residues 426 and 450. Four peptides, including the epitope, were selected from a random fragment cDNA library of 1D using a pool of sera from 4 patients with thyroid associated ophthalmopathy.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.