Epitope mapping of cytochrome P450 cholesterol side-chain cleavage enzyme by sera from patients with autoimmune polyglandular syndrome type 1.

Title:

Epitope mapping of cytochrome P450 cholesterol side-chain cleavage enzyme by sera from patients with autoimmune polyglandular syndrome type 1.

identifier:	1764138
description:	epitope description:MLAKGLPPRSVLVKGYQTFLSAPREGLGRLRVPTGEGAGI antigen name:Cholesterol side-chain cleavage enzyme, mitochondrial host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	11751076

study type:	b cell assays
subject species:	Homo sapiens

fullName:	Ingrid Liiv Kaupo Teesalu Pä rt Peterson Maria Gracia Clemente Jaakko Perheentupa Raivo Uibo

method:	western blot

name:	Epitope mapping of cytochrome P450 cholesterol side-chain cleavage enzyme by sera from patients with autoimmune polyglandular syndrome type 1.
description:	The epitope sequence was published in the cited reference Chung et al., Proc Natl Acad Sci U S A. 1986 Dec 83(23):8962-6, [PMID: 3024157].

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.