| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1019295 |
| landingPage: |
http://www.iedb.org/assay/1764804 |
| type: |
Literature
|
| publicationVenue: |
Brain Res Bull
|
| dates: |
1986
|
| study type: | b cell assays |
| subject species: | Homo sapiens |
| fullName: |
M D Culler
A Negro-Vilar
|
| method: |
antigen inhibition
|
| name: |
Development of specific antisera and a radioimmunoassay procedure for the gonadotropin-releasing hormone associated peptide (GAP) of the LHRH prohormone.
|
| description: |
The peptide did not inhibit the binding of the epitope-specific antiserum to 125I-hGAP (1-56) peptide DAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI, measured by RIA.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |