Neuroprotective natural antibodies to assemblies of amyloidogenic peptides decrease with normal aging and advancing Alzheimer's disease.

Title:

Neuroprotective natural antibodies to assemblies of amyloidogenic peptides decrease with normal aging and advancing Alzheimer's disease.

identifier:	1802119
description:	epitope description:DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	19581601

study type:	b cell assays
subject species:	Homo sapiens

fullName:	M Britschgi C E Olin H T Johns Y M C LeMieux K Rufibach J Rajadas H Zhang B Tomooka W H Robinson C M Clark A M Fagan D R Galasko D M Holtzman M Jutel J A Kaye C A Lemere J Leszek G Li E R Peskind J F Quinn J A Yesavage J A Ghiso

method:	microarray

name:	Neuroprotective natural antibodies to assemblies of amyloidogenic peptides decrease with normal aging and advancing Alzheimer's disease.
description:	The epitope is a natural variant of the wild type sequence, but did not BLAST to any reported sequence and was therefore assigned an internal IEDB identifier. Human IgG reactivities against peptides preparations were measured with antigen microarrays in plasma from patients with Alzheimer's disease.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.