Anti-11[E]-pyroglutamate-modified amyloid beta antibodies cross-react with other pathological Abeta species: relevance for immunotherapy.

Title:

Anti-11[E]-pyroglutamate-modified amyloid beta antibodies cross-react with other pathological Abeta species: relevance for immunotherapy.

identifier:	1803504
description:	epitope description:EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA + MCM(E1) antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus New Zealand White
aggregation:	instance of dataset
availability:	available
primaryPublications:	20864186

study type:	b cell assays
subject species:	Homo sapiens

fullName:	Roxanna Perez-Garmendia Vanessa Ibarra-Bracamontes Vitaly Vasilevko Jose Luna-Muñ oz Raul Mena Tzipe Govezensky Gonzalo Acero Karen Manoutcharian David H Cribbs Goar Gevorkian

method:	ELISA

name:	Anti-11[E]-pyroglutamate-modified amyloid beta antibodies cross-react with other pathological Abeta species: relevance for immunotherapy.
description:	The epitope was modified by cyclization of the N-terminal glutamate resulting in a peptide bearing an amino-terminal pyroglutamate. Anti-epitope sera bound to the selected phage clone in direct ELISA, but the phage did not inhibit binding of anti-epitope sera to the epitope.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.