N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

Title:

N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

identifier:	1851306
description:	epitope description:NPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVG antigen name:Large envelope protein host organism:Mus musculus BALB/c
aggregation:	instance of dataset
availability:	available
primaryPublications:	21145866

study type:	b cell assays
subject species:	Hepatitis B virus

fullName:	Corinna M Bremer Irina Sominskaya Dace Skrastina Paul Pumpens Ahmed Abd El Wahed Ulrike Beutling Ronald Frank Hans-Joachim Fritz Gerhard Hunsmann Wolfram H Gerlich Dieter Glebe

method:	biological activity

name:	N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.
description:	The epitope-specific antisera neutralized HBV, as measured in vitro by mixing with HBV and primary hepatocytes from Tupaia belangeri (Asian tree shrews). The read-out was the amount of newly produced HBsAg in the cell culture medium 12–15 days postinfection.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.