Neuroprotective natural antibodies to assemblies of amyloidogenic peptides decrease with normal aging and advancing Alzheimer's disease.

Title:

Neuroprotective natural antibodies to assemblies of amyloidogenic peptides decrease with normal aging and advancing Alzheimer's disease.

identifier:	1898691
description:	epitope description:EASNCFAIRHFENKFAVETLICFNLFLNSQEKHY host organism:Chlorocebus aethiops
aggregation:	instance of dataset
availability:	available
primaryPublications:	19581601

study type:	b cell assays
subject species:

fullName:	M Britschgi C E Olin H T Johns Y M C LeMieux K Rufibach J Rajadas H Zhang B Tomooka W H Robinson C M Clark A M Fagan D R Galasko D M Holtzman M Jutel J A Kaye C A Lemere J Leszek G Li E R Peskind J F Quinn J A Yesavage J A Ghiso

method:	microarray

name:	Neuroprotective natural antibodies to assemblies of amyloidogenic peptides decrease with normal aging and advancing Alzheimer's disease.
description:	The natural epitope comprises aa1-22 [EASNCFAIRHFENKFAVETLIC]. By day 301 post-immunization, vervets developed a 370-fold median increase (range of 80- to 50,000-fold) in IgG antibodies to full-length beta amyloid preparations. Immunization with full-length beta amyloid not only increases immunity to select beta amyloid peptide species, but also triggers the expansion of cross-reactive antibodies against other known toxic amyloidogenic peptides. Reactivity to oligomeric forms of the epitope was greater.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.