Minor nucleotide substitutions in the omp31 gene of Brucella ovis result in antigenic differences in the major outer membrane protein that it encodes compared to those of the other Brucella species.

Title:

Minor nucleotide substitutions in the omp31 gene of Brucella ovis result in antigenic differences in the major outer membrane protein that it encodes compared to those of the other Brucella species.

Dataset

identifier:	1865605
description:	epitope description:NAGYAGGKFKHPFSSFDKEDGEHVSGSPDVTAGGFV antigen name:UniProt:A5VUA5 host organism:Mus musculus BALB/c antibody name:A01/08H06/G02
aggregation:	instance of dataset
availability:	available
primaryPublications:	11598077

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/873
landingPage:	http://www.iedb.org/assay/1865605

Publication

type:	Literature
publicationVenue:	Infect Immun
dates:	2001

Dimension

study type:	b cell assays
subject species:	Brucella ovis Reo 198

Person

fullName:	N Vizcaí no R Kittelberger A Cloeckaert C M Marí n L Ferná ndez-Lago

Data Type

method:	ELISA

Study

name:	Minor nucleotide substitutions in the omp31 gene of Brucella ovis result in antigenic differences in the major outer membrane protein that it encodes compared to those of the other Brucella species.
description:	The epitope-specific mAb reacted with E Coli bearing the recombinant plasmid which encoded the B. ovis 63/290 omp31 protein. Western Blot showed the same results.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.