Carrier-bound nonallergenic Der p 2 peptides induce IgG antibodies blocking allergen-induced basophil activation in allergic patients.

Title:

Carrier-bound nonallergenic Der p 2 peptides induce IgG antibodies blocking allergen-induced basophil activation in allergic patients.

identifier:	1931687
description:	epitope description:EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWIVPKIAPKSEN antigen name:Der p 2 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	22339348

study type:	b cell assays
subject species:	Dermatophagoides pteronyssinus

fullName:	K-W Chen M Focke- K Blatt M Kneidinger A Gieras F Dall'Antonia I Faé G Fischer W Keller P Valent R Valenta S Vrtala

method:	western blot

name:	Carrier-bound nonallergenic Der p 2 peptides induce IgG antibodies blocking allergen-induced basophil activation in allergic patients.
description:	Serum IgE from a nonallergic individuals did not react to the epitope-KLH conjugate in dot blot RAST-based assays.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.