Mapping of antigenic determinants on a SAT2 foot-and-mouth disease virus using chicken single-chain antibody fragments.

Title:

Mapping of antigenic determinants on a SAT2 foot-and-mouth disease virus using chicken single-chain antibody fragments.

identifier:	1945918
description:	epitope description:KYTQQSTAIRGDRAVLAAKYANTKRKLPSTFNFGYVTADK antigen name:Polyprotein host organism:Gallus gallus antibody name:scFv2
aggregation:	instance of dataset
availability:	available
primaryPublications:	22698877

study type:	b cell assays
subject species:	Foot-and-mouth disease virus - type SAT 2

fullName:	Pamela A Opperman Francois F Maree Wouter Van Wyngaardt Wilna Vosloo Jacques Theron

method:	antigen inhibition

name:	Mapping of antigenic determinants on a SAT2 foot-and-mouth disease virus using chicken single-chain antibody fragments.
description:	The authors state that the epitope is derived from the VP1 G-H loop region of Foot-and-mouth disease virus ZIM/7/83. However, no BLAST matches were found in the GenBank database. Binding of an epitope-specific scFv, shown to require residue 159 for binding, was found to be blocked by a synthetic peptide, of which the sequence was derived from the predicted epitope site on FMDV ZIM/7/83.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.