Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.

Title:

Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.

identifier:	1944835
description:	epitope description:KALDYEQLQSVKLSIAVKNKAEFHQSVISRYRV antigen name:Desmoglein-3 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	22261006

study type:	b cell assays
subject species:	Homo sapiens

fullName:	Jenny Dworschak Andreas Recke Miriam Freitag Ralf J Ludwig Jana Langenhan Oliver J Kreuzer Detlef Zillikens Enno Schmidt

method:	ELISA

name:	Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.
description:	Sera from pemphigus vulgaris patients tested for reactivity against overlapping peptides spanning the EC3 domain of Dsg 3 reacted with the epitope by ELISA and western blotting with significantly more binding as compared to sera from healthy controls. Epitope affinity purified antibodies from the sera also bound the epitope.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.