A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.

Dataset

identifier:	1966283
description:	epitope description:EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA + PYRE(E1) antigen name:Amyloid beta A4 protein host organism:Mus musculus
aggregation:	instance of dataset
availability:	available
primaryPublications:	23217740

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1025346
landingPage:	http://www.iedb.org/assay/1966283

Publication

type:	Literature
publicationVenue:	Neuron
dates:	2012

Dimension

study type:	b cell assays
subject species:	Homo sapiens

Person

fullName:	Ronald B Demattos Jirong Lu Ying Tang Margaret M Racke Cindy A Delong John A Tzaferis Justin T Hole Beth M Forster Peter C McDonnell Feng Liu Robert D Kinley William H Jordan Michael L Hutton

Data Type

method:	in vivo assay

Study

name:	A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.
description:	Treatment of APP mice with the epitope-specific mAbs demonstrate that these antibodies significantly lower existing plaque in aged PDAPP mice (expressing human Abeta) and reduce Alzheimer's disease without increasing microbleeds. The mAb mE8 was made in both mouse IgG1 and IgG2a isotypes.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.