| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1025379 |
| landingPage: |
http://www.iedb.org/assay/1966417 |
| type: |
Literature
|
| publicationVenue: |
Nature
|
| dates: |
2012
|
| study type: | b cell assays |
| subject species: | Human immunodeficiency virus 1 |
| fullName: |
Jinghe Huang
Gilad Ofek
Leo Laub
Mark K Louder
Nicole A Doria-Rose
Nancy S Longo
Hiromi Imamichi
Robert T Bailer
Bimal Chakrabarti
Shailendra K Sharma
S Munir Alam
Tao Wang
Yongping Yang
Baoshan Zhang
Stephen A Migueles
Richard Wyatt
Barton F Haynes
Peter D Kwong
John R Mascola
Mark Connors
|
| method: |
ELISA
|
| name: |
Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.
|
| description: |
The epitope-specific mAb Z13e1 bound to the epitope. Mab Z13e1 also bound to the longer MPER peptide (KKKNEQELLELDKWASLWNWFDITNWLWYIRKKK) and the overlapping 4E10 peptide (CNWFDITNWLWYIRKKK).
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |