A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.

Dataset

identifier:	1970266
description:	epitope description:EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA + PYRE(E1) antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:mE8
aggregation:	instance of dataset
availability:	available
primaryPublications:	23217740

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1025346
landingPage:	http://www.iedb.org/assay/1970266

Publication

type:	Literature
publicationVenue:	Neuron
dates:	2012

Dimension

study type:	b cell assays
subject species:	Homo sapiens

Person

fullName:	Ronald B Demattos Jirong Lu Ying Tang Margaret M Racke Cindy A Delong John A Tzaferis Justin T Hole Beth M Forster Peter C McDonnell Feng Liu Robert D Kinley William H Jordan Michael L Hutton

Data Type

method:	ELISA

Study

name:	A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.
description:	Binding of the antibody was measured by Biacore. The epitope-specific mAb recognized the peptide.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.