A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts immune responses to a tolerogenic and Th1 phenotype.

Title:

Dataset

identifier:	1975774
description:	epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Oryctolagus cuniculus New Zealand White
aggregation:	instance of dataset
availability:	available
primaryPublications:	23440415

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1025639
landingPage:	http://www.iedb.org/assay/1975774

Publication

type:	Literature
publicationVenue:	J Immunol
dates:	2013

Dimension

study type:	b cell assays
subject species:	Betula pendula

Person

fullName:	Katharina Marth Isabella Breyer Margarete Focke-Tejkl Katharina Blatt Mohamed H Shamji Janice Layhadi Anna Gieras Ines Swoboda Domen Zafred Walter Keller Peter Valent Stephen R Durham Rudolf Valenta

Data Type

method:	ELISA

Study

name:	A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts immune responses to a tolerogenic and Th1 phenotype.
description:	Sera from rabbits immunized with Bet v 1 weakly recognized the epitope.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.