In vitro and in vivo characterization of designed immunogens derived from the CD-helix of the stem of influenza hemagglutinin.

Title:

In vitro and in vivo characterization of designed immunogens derived from the CD-helix of the stem of influenza hemagglutinin.

identifier:	1989832
description:	epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQH antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1
aggregation:	instance of dataset
availability:	available
primaryPublications:	23625724

study type:	b cell assays
subject species:	Influenza A virus (A/Hong Kong/1/1968(H3N2))

fullName:	V Vamsee Aditya Mallajosyula Michael Citron Xianghan Lu Jan Ter Meulen Raghavan Varadarajan Xiaoping Liang

method:	ELISA

name:	In vitro and in vivo characterization of designed immunogens derived from the CD-helix of the stem of influenza hemagglutinin.
description:	The epitope-specific mAb recognized the biotinylated peptide and to a lesser extent, the peptide conjugated to KLH. The peptide consists of residues 76–130 of HA2 followed by a Flag tag.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.