Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the protein post-fusion conformation.

Title:

Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the protein post-fusion conformation.

Dataset

identifier:	2113092
description:	epitope description:DPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHHVNAGK antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand White
aggregation:	instance of dataset
availability:	available
primaryPublications:	25010277

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1028003
landingPage:	http://www.iedb.org/assay/2113092

Publication

type:	Literature
publicationVenue:	Virology
dates:	2014

Dimension

study type:	b cell assays
subject species:	Human respiratory syncytial virus A strain Long

Person

fullName:	Concepció n Palomo Vicente Mas Mó nica Vá zquez Olga Cano Daniel Luque Marí a C Terró n Lesley J Calder José A Melero

Data Type

method:	ELISA

Study

name:	Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the protein post-fusion conformation.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Related Publications

Feedback?