Epitope Mapping of Antibodies to Alpha-Synuclein in LRRK2 Mutation Carriers, Idiopathic Parkinson Disease Patients, and Healthy Controls.

Title:

Epitope Mapping of Antibodies to Alpha-Synuclein in LRRK2 Mutation Carriers, Idiopathic Parkinson Disease Patients, and Healthy Controls.

identifier:	2115666
description:	epitope description:EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAP antigen name:Alpha-synuclein host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	25076905

study type:	b cell assays
subject species:	Homo sapiens

fullName:	Beatriz Alvarez-Castelao Ana Gorostidi Javier Ruí z-Martí nez Adolfo Ló pez de Munain José G Castañ o

method:	western blot

name:	Epitope Mapping of Antibodies to Alpha-Synuclein in LRRK2 Mutation Carriers, Idiopathic Parkinson Disease Patients, and Healthy Controls.
description:	The epitope sequence was cited in Alvarez-Castelao et al. Biochim Biophys Acta. 2014 Feb 1843(2):352-65. doi: 10.1016/j.bbamcr.2013.11.018 [PMID:24315858]. The epitope sequence was deduced by study of overlapping peptides. Two of the plasma from healthy controls recognized the peptide in Western blot.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.